General Information

  • ID:  hor005317
  • Uniprot ID:  P23442
  • Protein name:  Islet amyloid polypeptide
  • Gene name:  IAPP
  • Organism:  Mesocricetus auratus (Golden hamster)
  • Family:  Calcitonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mesocricetus (genus), Cricetinae (subfamily), Cricetidae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  KCNTATCATQRLANFLVHSNNNLGPVLSPTNVGSNTY
  • Length:  37(37-73)
  • Propeptide:  MHISKLPAALLIFSVALNHLKATPVRSGTNHQMDKRKCNTATCATQRLANFLVHSNNNLGPVLSPTNVGSNTYGKRSAAEIPDGDSLDLFLL
  • Signal peptide:  MHISKLPAALLIFSVALNHLKA
  • Modification:  T37 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Calcr
  • Target Unid:  A0A3Q0D7K7
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45695
  • Structure ID:  AF-P23442-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005317_AF2.pdbhor005317_ESM.pdb

Physical Information

Mass: 456368 Formula: C166H267N51O55S2
Absent amino acids: DEIMW Common amino acids: N
pI: 8.8 Basic residues: 3
Polar residues: 20 Hydrophobic residues: 11
Hydrophobicity: -26.49 Boman Index: -5569
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 73.78
Instability Index: 976.49 Extinction Coefficient cystines: 1615
Absorbance 280nm: 44.86

Literature

  • PubMed ID:  2251153
  • Title:  Sequence of a cDNA encoding Syrian hamster islet amyloid polypeptide precursor.